DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ing5

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_988867.1 Gene:ing5 / 394462 XenbaseID:XB-GENE-1004249 Length:236 Species:Xenopus tropicalis


Alignment Length:284 Identity:143/284 - (50%)
Similarity:182/284 - (64%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERR 65
            |::|:|||:|||.:|:||.||:|||:||..||.|.:...|.||:.|.:::.|:.:   .:.::|.
 Frog     1 MATAMYLEHYLDSIENLPCELQRNFQLMSDLDQRTEDKKKEIDALASEYIAKVRD---YTPEQRV 62

  Fly    66 ERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVA 130
            :..:.|::.:.|.|||||||||||:||||:|||.|||||.||||||.:::||...:...|.   |
 Frog    63 QHLQKIQSAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKEKLEGSEFDSP---A 124

  Fly   131 KKGRKKTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKG 195
            .:|.||.:     |:|:|..|      ||...|..::           .||||         .||
 Frog   125 GRGVKKNR-----GQKEKRGS------RGRRVSEEDT-----------VKKKK---------MKG 158

  Fly   196 GAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHF 260
            |    .|..|.       ..:..||||:|||||||||||||||||||||||||||||||||||||
 Frog   159 G----PVYADS-------VLSVTPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHF 212

  Fly   261 ACVGLTTKPKGKWFCPKCTQDRKK 284
            |||.||||||||||||:|||:|||
 Frog   213 ACVDLTTKPKGKWFCPRCTQERKK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 137/276 (50%)
ING 6..108 CDD:289749 51/101 (50%)
PHD_ING4_5 234..278 CDD:277061 42/43 (98%)
ing5NP_988867.1 TNG2 1..230 CDD:227367 137/276 (50%)
ING_ING5 12..104 CDD:341096 45/94 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55959
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm48072
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.