DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and MESR4

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:421 Identity:80/421 - (19%)
Similarity:135/421 - (32%) Gaps:179/421 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAK 79
            |..|.....|:.::    :.::.:..|:...|..|..|  .....::.::|||:...|:  ||.:
  Fly  1758 EHAPMRPSNNYDIV----ENSRPSTPSLPEEASAFADK--REKVRNKKKKRERKSTCKS--GKLQ 1814

  Fly    80 EYSD------DKV-----QLA-------------IQTYELVDKQIRRLDNDLARFEGEIQEKASS 120
            ..:.      |::     .:|             ...:.:.....|:|.:.:.|    :.|.:|.
  Fly  1815 PVASTTPPPMDRIPGMPGMIAPLEPPTPILSHPESSLFPVTPLTHRQLQSSMTR----MSEGSSC 1875

  Fly   121 TRAKSEEVVAKKGRKKTKDSKTTGKKKKSASSDEET----------------------------- 156
            :.|..:   .|:.:::.:.:|..|     .:||:|.                             
  Fly  1876 SDADGQ---LKRSKRQRRPNKFYG-----YTSDDENMSAVLAPPLQVGMQLIKPQPPPQLTWAKE 1932

  Fly   157 -------GRGNNQSNANSSVNSSSNAGQ-GSKKKKSKVNQEKETRKGGAQK-------------- 199
                   .|..|.:|::...:|.||.|. ||.:|:||  |......||::.              
  Fly  1933 DLPTPPKQRNRNNNNSSHHHHSHSNGGMAGSSRKRSK--QRSLFGAGGSRPAKRHKPDPNDHLPP 1995

  Fly   200 -KTVEV-------------------DDSEKESCHTAAT-----HPSDVMD------MPVDP---- 229
             .|:::                   ||.|.|...|:..     .|..|:.      :||.|    
  Fly  1996 IPTLKIRPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPAPPPVLPTPLPVALPVPPPPPP 2060

  Fly   230 -----NEP------------------------------------------TYCLCHQVSYGEMIG 247
                 |:|                                          .||.|......|||.
  Fly  2061 AATAFNQPIPPALLPNPGFATLQYFKANNIRYPIRPPAGARLAREGESVYCYCRCPYDEVSEMIA 2125

  Fly   248 CDNPDCPIEWFHFACVGLTTKPKGKWFCPKC 278
            ||..:|.||||||.|||:...|:|||||.:|
  Fly  2126 CDGDNCLIEWFHFECVGIMVAPQGKWFCAEC 2156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 79/419 (19%)
ING 6..108 CDD:289749 17/116 (15%)
PHD_ING4_5 234..278 CDD:277061 24/43 (56%)
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 24/45 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1994
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.