DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ING1

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_005528.4 Gene:ING1 / 3621 HGNCID:6062 Length:422 Species:Homo sapiens


Alignment Length:248 Identity:87/248 - (35%)
Similarity:138/248 - (55%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 MKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRL 103
            :|.:|...:.|.|:  .:||    ::|.....::....:::|..|:|:|:..|..|||:.:.|::
Human   191 LKELDECYERFSRE--TDGA----QKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQV 249

  Fly   104 DNDLARFEGEIQEKASSTRAKSEEVVA--KKGRKKTKDSKTTGKKKKSASSDEETGRGNNQSNAN 166
            |:.:..||.  |::...|...|.:..|  .||....:..|...|:.:...::|      |:.||:
Human   250 DSHVELFEA--QQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNE------NRENAS 306

  Fly   167 SSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNE 231
            |:.:....|....|:||:|.:::|:..|..|:::                   :...|:|:||||
Human   307 SNHDHDDGASGTPKEKKAKTSKKKKRSKAKAERE-------------------ASPADLPIDPNE 352

  Fly   232 PTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKK 284
            ||||||:||||||||||||.:||||||||:||||..||||||:||||..:.:|
Human   353 PTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 84/240 (35%)
ING 6..108 CDD:289749 17/68 (25%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)
ING1NP_005528.4 ING <189..254 CDD:289749 17/68 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..349 22/112 (20%)
PHD_ING1_2 355..399 CDD:277059 36/43 (84%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 405..422 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.