DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and taf3

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001036209.1 Gene:taf3 / 334474 ZFINID:ZDB-GENE-030131-6406 Length:898 Species:Danio rerio


Alignment Length:434 Identity:81/434 - (18%)
Similarity:123/434 - (28%) Gaps:194/434 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMRKLDDRAQTAMKSID-SHAKDFMRKLGENGAMSEDERRERQ--------------------ED 70
            |.:||....:|.:|..| ...|:..::.|:|...:::::||::                    |:
Zfish   482 LKKKLKKDIKTKLKKKDKERLKEKGKEKGKNKEKNKEKKREKERGQVEENKMPWPELSLVVGGEE 546

  Fly    71 IKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAK---- 131
            .:...|..||....|           ||   :.|.:..:.|.|.::|... |.|.|:.:::    
Zfish   547 RRDGIGGKKEKDKHK-----------DK---KKDKEKGKKEKEKRDKGKE-RGKEEKRISQGTKD 596

  Fly   132 ---------------------------------------------KGRKKTKDSKTTGKKKKSAS 151
                                                         |.:.|.||.|.. ||||...
Zfish   597 IAIAVAGATSPLFSPQTCLRIPSMLPPLPPILPDKLFPHPKDIKSKDKDKKKDKKEK-KKKKEKE 660

  Fly   152 SDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKE------------------------- 191
            .|.|..|...:....:.........:...|:|.:..:|||                         
Zfish   661 KDREKEREKEREKERTKEKERDKEEKKKDKEKKEKTKEKEKDKPKLEKTSLMAEIPPAVPPSPVI 725

  Fly   192 ----TRKGGAQKKTV---EVDDSE----------------------------KESCHTAATHPSD 221
                .|.|..|.|.|   .|.|:|                            .....|....|..
Zfish   726 PRLTLRVGAGQDKIVISKVVPDTEPTPPPPRTPVARMGPGARIRPPPVLPPPAPPPATPPPRPPP 790

  Fly   222 VMDMPVDPNEP---------------------TYCL-------------CHQVSYGE-MIGCDNP 251
            |:..|..|..|                     .|.:             |::...|. |||||..
Zfish   791 VLPPPPPPAAPIQTPPNQAKARGCSVVTETVSAYVIRDEWGNQIWICPGCNKADDGSPMIGCDEC 855

  Fly   252 DCPIEWFHFACVGLTTKP--KGKWFCPKC--------TQDRKKK 285
            |   :|:|:.||||...|  ...|||.||        |:.||:|
Zfish   856 D---DWYHWPCVGLLAAPPEDQSWFCIKCAGKKKDKKTKKRKRK 896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 75/417 (18%)
ING 6..108 CDD:289749 19/101 (19%)
PHD_ING4_5 234..278 CDD:277061 19/59 (32%)
taf3NP_001036209.1 BTP 5..79 CDD:128846
PHD_TAF3 836..881 CDD:276997 18/47 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.