DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and Ing4

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_006237411.1 Gene:Ing4 / 297597 RGDID:1309407 Length:249 Species:Rattus norvegicus


Alignment Length:296 Identity:141/296 - (47%)
Similarity:180/296 - (60%) Gaps:58/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERR 65
            |::.:|||:|||.:|:||.||:|||:|||.||.|.:.....||..|.::|   ....::|.:|:.
  Rat     1 MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYM---SSARSLSSEEKL 62

  Fly    66 ERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEK--------ASSTR 122
            .....|:..:||.||:.|||||||:||||:|||.|||||.||||||.:::||        :||::
  Rat    63 ALLRQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSK 127

  Fly   123 AKSEEVVAKKGRKKTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVN 187
            .|      :|||.: |:.|....:.|..:||||..:                             
  Rat   128 GK------RKGRTQ-KEKKAARARSKGKNSDEEAPK----------------------------- 156

  Fly   188 QEKETRKGGAQKKTVEVDDSEK---ESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCD 249
                    .||||...|..|.:   .|....:.|||||:||||||||||||||||||||||||||
  Rat   157 --------AAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCD 213

  Fly   250 NPDCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKKK 285
            ||||.|||||||||||||||:||||||:|:|:||||
  Rat   214 NPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 135/287 (47%)
ING 6..108 CDD:289749 51/101 (50%)
PHD_ING4_5 234..278 CDD:277061 41/43 (95%)
Ing4XP_006237411.1 TNG2 7..245 CDD:227367 134/284 (47%)
ING_ING4 11..104 CDD:341095 46/95 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3783
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22952
Inparanoid 1 1.050 260 1.000 Inparanoid score I3031
OMA 1 1.010 - - QHG55959
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm45014
orthoMCL 1 0.900 - - OOG6_101415
Panther 1 1.100 - - LDO PTHR10333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.