DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and Ing2

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_006253193.1 Gene:Ing2 / 290744 RGDID:1307347 Length:316 Species:Rattus norvegicus


Alignment Length:268 Identity:82/268 - (30%)
Similarity:128/268 - (47%) Gaps:79/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQI 100
            |..:|.||...:.:.::...|      :::..|:.::.....::|..|:|:|:..|..|||:.:.
  Rat    93 QETLKEIDDVYEKYKKEDDSN------QKKRLQQHLQRALINSQELGDEKIQIVTQMLELVENRA 151

  Fly   101 RRLDNDLARFEGEIQEKASSTRAKSEEVVAKKG-----RKKTKDSK-----TTG---------KK 146
            |:::.....|:...:.:.:|.::|.:....::.     |::|.:|:     |.|         |:
  Rat   152 RQMELHSQCFQDPAESERASDKSKMDSSQPERSSRRPRRQRTSESRDLCHMTNGIDDCDDQPPKE 216

  Fly   147 KKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKKTVEVDDSEKES 211
            |||.|:                          .|||:||..||:|                    
  Rat   217 KKSKSA--------------------------KKKKRSKAKQERE-------------------- 235

  Fly   212 CHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCP 276
                    :..::..:||||||||||:||||||||||||..||||||||:||.||.||||||:||
  Rat   236 --------ASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCP 292

  Fly   277 KCTQDRKK 284
            ||..|.:|
  Rat   293 KCRGDSEK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 78/260 (30%)
ING 6..108 CDD:289749 15/71 (21%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)
Ing2XP_006253193.1 ING <93..157 CDD:289749 15/69 (22%)
PHD_ING2 249..297 CDD:277153 39/47 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.