DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and Ing1

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_036049.2 Gene:Ing1 / 26356 MGIID:1349481 Length:279 Species:Mus musculus


Alignment Length:287 Identity:103/287 - (35%)
Similarity:165/287 - (57%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQED 70
            |:|:|||.:||||.:|:||..|||::|.:.|..:|.:|.:.:.|.|:  .:|.    ::|.....
Mouse    15 YVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRE--TDGT----QKRRVLHC 73

  Fly    71 IKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEG--EIQE------KASSTRAKSEE 127
            |:....:::|..|:|:|:..|..|||:.:.|::|:.:..||.  :|.:      ||...::|||.
Mouse    74 IQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDISDGTGGSGKAGQDKSKSEA 138

  Fly   128 VVAKKGRKKTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKET 192
            :        |:..|...|:.:...::|      |:.||:::.:.........|:||:|.:::|:.
Mouse   139 I--------TQADKPNNKRSRRQRNNE------NRENASNNHDHDDITSGTPKEKKAKTSKKKKR 189

  Fly   193 RKGGAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEW 257
            .|..|:::                   :...|:|:||||||||||:||||||||||||.:|||||
Mouse   190 SKAKAERE-------------------ASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEW 235

  Fly   258 FHFACVGLTTKPKGKWFCPKCTQDRKK 284
            |||:||||..||||||:||||..:.:|
Mouse   236 FHFSCVGLNHKPKGKWYCPKCRGESEK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 100/279 (36%)
ING 6..108 CDD:289749 34/101 (34%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)
Ing1NP_036049.2 ING 15..111 CDD:315637 34/101 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..206 22/123 (18%)
PHD_ING1_2 212..256 CDD:277059 36/43 (84%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 262..279 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.