DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and phf-34

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_509661.1 Gene:phf-34 / 184793 WormBaseID:WBGene00009025 Length:246 Species:Caenorhabditis elegans


Alignment Length:196 Identity:45/196 - (22%)
Similarity:71/196 - (36%) Gaps:51/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ARFEGE------------IQEKASSTRAKSEEVVAKKGRKKTKDSKTTGKKK-------KSASSD 153
            :||..|            :.|:.|..|||::..:..|..|:.|..:...:|:       |:..|.
 Worm    76 SRFTAEEIENMTELCPTHLDEQLSEERAKAKAALEAKLAKQLKQMQAKHRKEIKEAEMAKTIRST 140

  Fly   154 EETGRGNNQSNANSSVNSSSNAGQGSK--KKKSKVNQEKETRKGGAQKKTVEVDDSEKESCHTAA 216
            ::|..|.|              |:.:|  ||.:|..:||:.......|..:..:|.::.....||
 Worm   141 KKTKVGKN--------------GKIAKVDKKTAKTVKEKQVLDLPQPKIEINDEDIDQYILEQAA 191

  Fly   217 THPSDVMDMPVDPNEPTYCLCHQVSYGEMIG-CDNPDCPIEWFHFACVGLTTKPK---GKWFCPK 277
            ....:|          |..:|.........| |....|. :|:|..|||. .|.|   .||.|..
 Worm   192 PKKKNV----------TRWICPTCDKSSKFGSCGCVGCG-DWYHITCVGF-KKAKEVPDKWACKY 244

  Fly   278 C 278
            |
 Worm   245 C 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 44/194 (23%)
ING 6..108 CDD:289749 45/196 (23%)
PHD_ING4_5 234..278 CDD:277061 14/47 (30%)
phf-34NP_509661.1 PHD 201..245 CDD:214584 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.