DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and lsy-13

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001367153.1 Gene:lsy-13 / 178470 WormBaseID:WBGene00020287 Length:247 Species:Caenorhabditis elegans


Alignment Length:261 Identity:61/261 - (23%)
Similarity:100/261 - (38%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQEDIKALFGKAKEY 81
            :|.:.::....:.:||..|:..|:....|..:|.....|   |:.:::.:....::....|..||
 Worm    21 VPEKAKKAIVEIERLDILAKKEMEVAKKHKIEFFANYEE---MTAEQKTKAFTFMQKKMAKVSEY 82

  Fly    82 SDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQE--KASSTRAKSEEVVAKKGRKKTKDSKTTG 144
            ||.|:::|.....|:.....:...:..:|...:.:  ||..|...|            ..|..:.
 Worm    83 SDQKIEIASGLKVLLKDVYGKFMEEEQKFIENLNKIPKAPETPPSS------------SPSVRSH 135

  Fly   145 KKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKKTVEVDDSEK 209
            :|||.:..|::         |.|||                     :.:|.|.:||    .:|||
 Worm   136 RKKKLSEGDDD---------APSSV---------------------DEKKRGRKKK----PESEK 166

  Fly   210 ESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWF 274
            .   .||..|..:           ||.|.......||.|:||.|...||||.|:|:.|.|.|.|:
 Worm   167 A---VAAAEPPKM-----------YCWCQLDKNDTMIECENPGCKYGWFHFTCIGMITAPAGDWY 217

  Fly   275 C 275
            |
 Worm   218 C 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 61/261 (23%)
ING 6..108 CDD:289749 17/90 (19%)
PHD_ING4_5 234..278 CDD:277061 20/42 (48%)
lsy-13NP_001367153.1 PHD_SF 177..222 CDD:419867 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55959
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.970

Return to query results.
Submit another query.