DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ing4

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_012823088.2 Gene:ing4 / 100491241 XenbaseID:XB-GENE-1013994 Length:288 Species:Xenopus tropicalis


Alignment Length:294 Identity:139/294 - (47%)
Similarity:182/294 - (61%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERR 65
            |::.:|||:|||.:|:||.||:|||:|||.||.|.:.....||..:..:|   ....:|:.:|:.
 Frog    26 MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKCHIDRLSCQYM---SNARSMNSEEKL 87

  Fly    66 ERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVA 130
            :....::..:||.|||.|||||||:||||:|||.|||||.||||||.:::||    ..:|.:.  
 Frog    88 QLLRQVQEAYGKCKEYGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEK----HIESSDY-- 146

  Fly   131 KKGRKKTKDSKTTGKKKKSASSDEET-------GRGNNQSNANSSVNSSSNAGQGSKKKKSKV-N 187
                    ||.::..||....:.:.|       |||..:..|              .|.:||| |
 Frog   147 --------DSCSSKGKKIPVLNWDNTLIILPAEGRGQKEKKA--------------AKVRSKVKN 189

  Fly   188 QEKETRKGGAQK-KTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNP 251
            .:.|..|...:| |.|:..:....:.:....|||||:||||||||||||||||||||||||||||
 Frog   190 SDDEAAKNTQKKIKLVQTAEYGAPAGNFGKVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNP 254

  Fly   252 DCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKKK 285
            ||.|||||||||||.|||:||||||:|:|:||||
 Frog   255 DCSIEWFHFACVGLATKPRGKWFCPRCSQERKKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 133/285 (47%)
ING 6..108 CDD:289749 50/101 (50%)
PHD_ING4_5 234..278 CDD:277061 40/43 (93%)
ing4XP_012823088.2 TNG2 32..284 CDD:227367 132/282 (47%)
ING_ING4 36..129 CDD:341095 45/95 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 160 1.000 Domainoid score I4028
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22952
Inparanoid 1 1.050 255 1.000 Inparanoid score I3083
OMA 1 1.010 - - QHG55959
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm48072
Panther 1 1.100 - - LDO PTHR10333
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.