DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing5 and ing1

DIOPT Version :9

Sequence 1:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001090790.1 Gene:ing1 / 100037882 XenbaseID:XB-GENE-960365 Length:279 Species:Xenopus tropicalis


Alignment Length:282 Identity:107/282 - (37%)
Similarity:170/282 - (60%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMSEDERRERQED 70
            |:|:|||.:||||.:|:||..|||::|.:.|..:|.:|.:.:.|.|: .::|     :::...:.
 Frog    15 YVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKRE-SDSG-----QKKRLLQF 73

  Fly    71 IKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASSTRAKSEEVVAKKGRK 135
            |:....:::|..|||:|:..|..|||:.:.|::|:.:..|| ..|:...||...|     |..::
 Frog    74 IQRALIRSQELGDDKIQIVSQMVELVENRTRQVDSHVELFE-TCQDLNDSTSNSS-----KNNQE 132

  Fly   136 KTKDSKTTGKKKKSASSDEETGR-GNNQSNANSSVN-SSSNAGQGS-KKKKSKVNQEKETRKGGA 197
            |.|:......:|   ||::.:.| .||::..||::| ...:...|: |:||||.:::|:..|..|
 Frog   133 KPKNEAIAQTEK---SSNKRSRRQRNNENRENSTINHDHDDLSSGTPKEKKSKPSKKKKRSKAKA 194

  Fly   198 QKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFAC 262
            :::                   :...|:|:||||||||||:||||||||||||.:||||||||:|
 Frog   195 ERE-------------------ASPADLPIDPNEPTYCLCNQVSYGEMIGCDNEECPIEWFHFSC 240

  Fly   263 VGLTTKPKGKWFCPKCTQDRKK 284
            |||..||||||:||:|..:.:|
 Frog   241 VGLNHKPKGKWYCPECRGENEK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing5NP_609647.1 TNG2 1..278 CDD:227367 105/274 (38%)
ING 6..108 CDD:289749 34/101 (34%)
PHD_ING4_5 234..278 CDD:277061 36/43 (84%)
ing1NP_001090790.1 ING_ING1 20..107 CDD:341093 30/92 (33%)
PHD_ING1 211..259 CDD:277152 38/47 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.