DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DGAT2L6 and Dgat2

DIOPT Version :9

Sequence 1:NP_940914.1 Gene:DGAT2L6 / 347516 HGNCID:23250 Length:337 Species:Homo sapiens
Sequence 2:NP_610318.1 Gene:Dgat2 / 35719 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster


Alignment Length:354 Identity:132/354 - (37%)
Similarity:196/354 - (55%) Gaps:43/354 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    19 LQWIPVYI-------------FLGAIPILLIPYFLLFSK---FWPLAVLSL--AWLTYDWNTHSQ 65
            ::|.|:.:             |...:.|||...|||.:.   :..|.|.||  .:|.|.:..|.:
  Fly     3 IEWAPLRVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGLLVRSLMVTYLAYVFVHHKK 67

Human    66 -----GGRRSAWV--RNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINFATE 123
                 .|  :.|:  |...|.:::|:||||:||||.:|....|||:|:.|||||..|:.||...|
  Fly    68 TQSVVDG--NGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLE 130

Human   124 ATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKG-----------SG 177
            .:....:||.:.|.:|||::.|.:|.:||.:...|:..||..||..:|::..           :.
  Fly   131 ISKWLELFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTS 195

Human   178 NAVVIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGTWL 242
            |||.|:||||.||:...||...|.||.|||||:||::||:.:|||:||||.::|:|...|..:.|
  Fly   196 NAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLL 260

Human   243 RLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPNQKTVDKY 307
            |    .|||..||:.|::.....||||...::|||||.|.|..|||.|:.:.:.:.|:.:.|||.
  Fly   261 R----RFQDFVKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKV 321

Human   308 HALYISALRKLFDQHKVEYGLPETQELTI 336
            |...|.:|.|||||:|.:| |..::..|:
  Fly   322 HGQVIESLEKLFDQYKDKY-LENSKSATL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DGAT2L6NP_940914.1 LPLAT 38..336 CDD:302626 125/320 (39%)
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 113/271 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146788
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.