DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and PRKRA

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_003681.1 Gene:PRKRA / 8575 HGNCID:9438 Length:313 Species:Homo sapiens


Alignment Length:339 Identity:118/339 - (34%)
Similarity:159/339 - (46%) Gaps:66/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAAR 198
            |||:.:|.|...:....|.||..:.:..||.|||.|||:..|    .|..|.|.|||.|||.||.
Human    33 KTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGD----ITCTGEGTSKKLAKHRAAE 93

  Fly   199 ALIDKL-IGAQL------PESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVGNPIGWLQ 256
            |.|:.| ..|.:      |..|..|..|                          |...||||.||
Human    94 AAINILKANASICFAVPDPLMPDPSKQP--------------------------KNQLNPIGSLQ 132

  Fly   257 EMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRLQETPI 321
            |:.:...|..|.|....|.|..|:|.:|..|.:.::.|.|||.|||.|||.||.:...:....  
Human   133 ELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNI-- 195

  Fly   322 DSGKISDSICGELEGEPRSSENYYGELKDISVPTLTTQHSNKVSQFHKTLKNATGKKLLKLQKTC 386
                              |.||:......:......|.||         |:|:.|:|:..|:::.
Human   196 ------------------SPENHISLTNVVGHSLGCTWHS---------LRNSPGEKINLLKRSL 233

  Fly   387 LKNNKIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLPVGVCHGSGPTAADAQRHA 451
            |.....|||:||.|||.|..|.:||:||:|.:.:||:|||.:|||.|:.||||||.:..:||..|
Human   234 LSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDA 298

  Fly   452 AQNALEYLKIMTKK 465
            |.|||:||||:.::
Human   299 AHNALQYLKIIAER 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 28/67 (42%)
DSRM 250..316 CDD:238007 28/65 (43%)
DSRM 394..460 CDD:214634 37/65 (57%)
PRKRANP_003681.1 Sufficient for self-association and interaction with TARBP2 1..103 31/73 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
DSRM_PRKRA_rpt1 32..102 CDD:380718 31/72 (43%)
Sufficient for self-association and interaction with TARBP2 102..195 34/118 (29%)
DSRM_PRKRA_rpt2 126..192 CDD:380720 28/65 (43%)
Sufficient for self-association and interaction with TARBP2 195..313 53/147 (36%)
DSRM_PRKRA_rpt3 239..310 CDD:380721 41/70 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158118
Domainoid 1 1.000 80 1.000 Domainoid score I8641
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2738
Inparanoid 1 1.050 169 1.000 Inparanoid score I4140
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1093169at2759
OrthoFinder 1 1.000 - - FOG0003036
OrthoInspector 1 1.000 - - otm42147
orthoMCL 1 0.900 - - OOG6_107751
Panther 1 1.100 - - LDO PTHR46205
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5487
SonicParanoid 1 1.000 - - X2027
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.