DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Stau1

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_445888.1 Gene:Stau1 / 84496 RGDID:621778 Length:495 Species:Rattus norvegicus


Alignment Length:407 Identity:96/407 - (23%)
Similarity:151/407 - (37%) Gaps:111/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KTPVSILQELLSRRGITPGYE---LVQI---EGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEA 192
            |:.:|.:.|:..:|.:...:|   |.|:   .|..|...|..|||..:    |...|.|:|||.:
  Rat    95 KSEISQVFEIALKRNLPVNFESFPLTQVARESGPPHMKNFVTRVSVGE----FVGEGEGKSKKIS 155

  Fly   193 KHAAARALIDKLIGAQLPESPS---------SSAGPSVTGLTVAGSGGDGNANATGGGDASDKTV 248
            |..||||::::|  .:||..|:         ..:.|:.. |..|...|.|.              
  Rat   156 KKNAARAVLEQL--RRLPPLPAVERVKPRIKKKSQPTCK-LQTAPDYGQGM-------------- 203

  Fly   249 GNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMW 313
             |||..|.::...::...|.|...||.|||..|.|.:...:.::...|.|.:||:|||.||..|.
  Rat   204 -NPISRLAQIQQAKKEKEPEYMLLTERGLPRRREFVMQVKVGHHTAEGAGTNKKVAKRNAAENML 267

  Fly   314 MRL-----------------QETPI----DSGKISDSICGELEGEPRSSENYYGELKDISVPTLT 357
            ..|                 ::||:    |..|::     ..|..|........:..:..:|.|:
  Rat   268 EILGFKVPQAQPAKPALKSEEKTPVKKPGDGRKVT-----FFEPSPGDENGTSNKEDEFRMPYLS 327

  Fly   358 TQ--------------HSNKVSQFHKTLKNA--------------TGKKLL-----KLQKTCLKN 389
            .|              .:..|||.|.|...|              ..::||     ...:|.||:
  Rat   328 HQQLPAGILPMVPEVAQAVGVSQGHHTKDFARAAPNPAKATVTAMIARELLYGGTSPTAETILKS 392

  Fly   390 N----------KIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQC--LVQLSTLPVGVCHGSGP 442
            |          :....:.|..::....|:|.|.|..:   :.:.:|  |:..|:.|..|.||.|.
  Rat   393 NISSGHVPHGPRTRPSEQLYYLSRAQGFQVEYKDFPK---NNKNECVSLINCSSQPPLVSHGIGK 454

  Fly   443 TAADAQRHAAQNALEYL 459
            ........||.|.|:.|
  Rat   455 DVESCHDMAALNILKLL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 23/73 (32%)
DSRM 250..316 CDD:238007 23/65 (35%)
DSRM 394..460 CDD:214634 18/68 (26%)
Stau1NP_445888.1 DSRM_SF 1..70 CDD:412133
DSRM_SF 95..167 CDD:412133 24/75 (32%)
DSRM_STAU1_rpt4 194..279 CDD:380714 27/99 (27%)
Staufen_C 366..475 CDD:374568 24/109 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.