DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Ilf3

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_008764212.1 Gene:Ilf3 / 84472 RGDID:619734 Length:915 Species:Rattus norvegicus


Alignment Length:192 Identity:53/192 - (27%)
Similarity:76/192 - (39%) Gaps:27/192 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PVSILQELLSRRGITPG--YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAK-HAAA 197
            |...:..|:....:.||  |:|:...|.:|.|.|...|.....    |...:|.|||.|| |.|.
  Rat   417 PPQAMNALMRLNQLKPGLQYKLISQTGPVHAPIFTMSVEVDGS----TFEASGPSKKTAKLHVAV 477

  Fly   198 RALIDKLI--GAQLPES-------------PSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKT 247
            :.|.|..:  ||:..:|             |:..|.|.|.......|....:...|..|....|.
  Rat   478 KVLQDMGLPTGAEGRDSSKGEDSAEESDGKPAVVAPPPVVEAVSNPSSVFPSDATTEQGPILTKH 542

  Fly   248 VGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA 309
            ..||:..|.|   :||  ...||..:|.|..|::.|.:...:...:..|.|.:||:||..||
  Rat   543 GKNPVMELNE---KRR--GLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAA 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 22/70 (31%)
DSRM 250..316 CDD:238007 20/60 (33%)
DSRM 394..460 CDD:214634
Ilf3XP_008764212.1 DZF 106..360 CDD:128842
DSRM_ILF3_rpt1 416..488 CDD:380739 22/74 (30%)
DSRM_ILF3_rpt2 538..609 CDD:380741 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.