DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Adad2

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_083704.1 Gene:Adad2 / 75773 MGIID:1923023 Length:561 Species:Mus musculus


Alignment Length:435 Identity:92/435 - (21%)
Similarity:149/435 - (34%) Gaps:136/435 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSSLPQQLQNLHIQPQQASPN----PVQTG-FAPRRHYNNLVG-----------LGNGNAVSGSP 56
            |...|:...:|.|.|....|:    |.:.| .|||...:.:.|           || |:.:|..|
Mouse     8 GRRRPRLAASLQISPGPWKPSGGQEPTEAGDAAPRTAEHGVAGAQEAHREACKALG-GSVLSPGP 71

  Fly    57 VKGAPLGQRH--VKLKKEKISAQ-VAQLSQPGQ---LQLSDVGDPALAGGSGLQGGVGLMGVILP 115
            ....| |..|  ..|.|:...|| ||.|:|...   :.|:.:.|.....||.......|.|::.|
Mouse    72 AGDFP-GALHGLSMLPKDPPPAQAVALLTQCMANLGVSLTFLEDQTAGPGSSFSVCADLDGLVCP 135

  Fly   116 SDEALKFVSETDANGLAMKTPVSILQELLSRRG--ITPGYEL---VQIEGAI-HEPTFRFRVS-- 172
            :...   .|:.:|...|..:.:..:|:.|.|..  :||...|   :.||..: ||......||  
Mouse   136 AGTG---SSKLEAKQQAALSALQYIQKQLERPEPLVTPRQPLLTSLSIETILTHEQRCAAVVSAG 197

  Fly   173 ---FKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGN 234
               ...:.:|:.|         .|...|..::::.:...:..|..:.   .:..|      |.|:
Mouse   198 LDRLLSESSPYQA---------CKGTVAAVILEREVQGSIGHSKETY---ELVAL------GTGS 244

  Fly   235 ANATGGGDASDK--------------------------TVGNPIGWLQEMCMQRRWPPPS----- 268
            ::..|..:.|.:                          |.|.|.|  ||..:....|.|.     
Mouse   245 SSCAGWLEFSGRRLHDCHGLVIARRALLRFFFRQLLLVTQGGPKG--QERSVLTPQPGPGPPFAL 307

  Fly   269 --------YETETEVGLPHERLFTIAC--SILNYREMGKGKSKKIAKRLAAHRMWMRLQETPIDS 323
                    |.:.|..|..|:....:|.  |:|:          ..|.||.||             
Mouse   308 KPGVFLHLYVSNTPKGAAHDIYLPLASEDSVLH----------SPAFRLQAH------------- 349

  Fly   324 GKISDSICGELEGEPRSSENYYG-ELKDISVPTLTTQHSNKVSQF 367
                  :||:|  :|.|   |.. .|:|..|..|:.  |:|::::
Mouse   350 ------VCGQL--KPVS---YVAPALRDTHVGCLSA--SDKLARW 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 16/78 (21%)
DSRM 250..316 CDD:238007 18/80 (23%)
DSRM 394..460 CDD:214634
Adad2NP_083704.1 DSRM 101..157 CDD:238007 10/58 (17%)
A_deamin 239..554 CDD:280326 37/187 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.