DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Adad2

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_038954126.1 Gene:Adad2 / 691275 RGDID:1586236 Length:561 Species:Rattus norvegicus


Alignment Length:206 Identity:46/206 - (22%)
Similarity:77/206 - (37%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QASPNPVQTGFAPRRHYNNLVGLGNGNAVSGSPVKGAPLGQRHVKLKKEKISAQVAQLSQPGQLQ 88
            |.||.|    :.|           :|...|.....|||........:::::..:..:..:...|.
  Rat    19 QISPGP----WRP-----------SGGQESTEVEDGAPGTDESGVAREQEVHGEACKALEGSVLS 68

  Fly    89 LSDVGDPALAGGSGLQGGVGLMGV-ILPSDEALKFVSETDANGLAMKTPVSILQELLSRRGITPG 152
            ....||..:|          |.|: :||.|       .:.|..:|      :|.:.::..|::  
  Rat    69 PGPAGDFPMA----------LRGLSLLPKD-------PSPAQAMA------LLTQYMANLGVS-- 108

  Fly   153 YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQL--PESPSS 215
              |..:|....:|...|.|. .:.|......|.|.||.|||..||.:.: :.|..||  ||...:
  Rat   109 --LTFLEDQTADPGSSFSVC-AELDGLVCPAGTGSSKLEAKQQAALSAL-QYIQKQLERPELLVT 169

  Fly   216 SAGPSVTGLTV 226
            ...|.:|.|::
  Rat   170 PRQPLLTSLSI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 17/67 (25%)
DSRM 250..316 CDD:238007
DSRM 394..460 CDD:214634
Adad2XP_038954126.1 DSRM_SF 91..157 CDD:412133 19/77 (25%)
A_deamin 239..554 CDD:396626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.