Sequence 1: | NP_609646.1 | Gene: | loqs / 34751 | FlyBaseID: | FBgn0032515 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038954126.1 | Gene: | Adad2 / 691275 | RGDID: | 1586236 | Length: | 561 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 47/206 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 QASPNPVQTGFAPRRHYNNLVGLGNGNAVSGSPVKGAPLGQRHVKLKKEKISAQVAQLSQPGQLQ 88
Fly 89 LSDVGDPALAGGSGLQGGVGLMGV-ILPSDEALKFVSETDANGLAMKTPVSILQELLSRRGITPG 152
Fly 153 YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQL--PESPSS 215
Fly 216 SAGPSVTGLTV 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
loqs | NP_609646.1 | DSRM | 136..204 | CDD:214634 | 17/67 (25%) |
DSRM | 250..316 | CDD:238007 | |||
DSRM | 394..460 | CDD:214634 | |||
Adad2 | XP_038954126.1 | DSRM_SF | 91..157 | CDD:412133 | 19/77 (25%) |
A_deamin | 239..554 | CDD:396626 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166352115 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |