DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and TARBP2

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_599150.1 Gene:TARBP2 / 6895 HGNCID:11569 Length:366 Species:Homo sapiens


Alignment Length:406 Identity:135/406 - (33%)
Similarity:190/406 - (46%) Gaps:93/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GSGLQGGVGLMGVILPSDEALKFVSETDANGLAM---KTPVSILQELLSRRGITPGYELVQIEGA 161
            |||...|.|     |||.|.:          ||.   |||:|:|||..:|.|.||.|:|::.||.
Human     7 GSGTTTGCG-----LPSIEQM----------LAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQ 56

  Fly   162 IHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLPE---------SPSSSA 217
            .|:|.|.|||:..|.    :..|.|.|||.|||.||...:..|.|..:.|         ||..|:
Human    57 AHQPNFTFRVTVGDT----SCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSS 117

  Fly   218 GP-SVTGLTVAGSGGDGNANATGGGD---------------ASDKTVGNPIGWLQEMCMQRRWPP 266
            .| .:...|.|       |.||....               :..::..||:|.|||:.:|:.|..
Human   118 LPEDIPVFTAA-------AAATPVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRL 175

  Fly   267 PSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRLQETPIDS-------- 323
            |.|....|.|..|.:.||:.|.:..:.|:|.|.|||:|||.||.:|.:|:...|:|:        
Human   176 PEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP 240

  Fly   324 --GKISDSICGELEGEPRSSENYYGELKDISVPTLTTQHSNKVSQFHKTLKNATGKKLLKLQKTC 386
              ...|..:...|:|           |::.. |..|..          :|:|:.|:|:|.|:...
Human   241 DDDHFSIGVGSRLDG-----------LRNRG-PGCTWD----------SLRNSVGEKILSLRSCS 283

  Fly   387 LKNNKIDYI-----KLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLPVGVCHGSGPTAAD 446
            |  ..:..:     ::|.|::.|..|.|:|:||||.:.||..||||:|||.|..|||||..|...
Human   284 L--GSLGALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREA 346

  Fly   447 AQRHAAQNALEYLKIM 462
            |:..||:.||:|||||
Human   347 ARGEAARRALQYLKIM 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 30/67 (45%)
DSRM 250..316 CDD:238007 28/65 (43%)
DSRM 394..460 CDD:214634 32/70 (46%)
TARBP2NP_599150.1 Sufficient for interaction with PRKRA 22..105 37/96 (39%)
DSRM_TARBP2_rpt1 27..98 CDD:380719 33/74 (45%)
Sufficient for interaction with PRKRA 152..234 31/81 (38%)
DSRM_TARBP2_rpt2 159..225 CDD:380681 28/65 (43%)
Sufficient for interaction with DICER1 228..366 51/159 (32%)
Sufficient for interaction with PRKRA 287..366 36/76 (47%)
DSRM_TARBP2_rpt3 292..363 CDD:380722 36/71 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10893
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4140
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45942
OrthoDB 1 1.010 - - D1093169at2759
OrthoFinder 1 1.000 - - FOG0003036
OrthoInspector 1 1.000 - - otm42147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2027
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.