DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and adad1

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001277142.1 Gene:adad1 / 564818 ZFINID:ZDB-GENE-030131-6285 Length:557 Species:Danio rerio


Alignment Length:278 Identity:60/278 - (21%)
Similarity:97/278 - (34%) Gaps:74/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSSLPQQLQNLHIQPQQASPNPVQTGFAPRRHYNNLVGLGNGNAVS-GSP------VKGAP---- 61
            |||:      .|......||:|..        :::...:.|.|..| |.|      :...|    
Zfish    10 GSSM------THSPWTNNSPSPPP--------FSDFTDINNNNRRSPGQPLVPNNKINSKPKILP 60

  Fly    62 --LGQRHVKLKKEKISAQVAQLSQPGQLQLSDVGDPALAGG------------SGLQGGVGLMGV 112
              |..|:.:.....:|| :.||||..|.|| |:.:.....|            .|:|...| || 
Zfish    61 RELIDRYKRGDTHPVSA-LYQLSQVLQFQL-DLKETVTTAGISGFYFAFCAVIDGIQYKTG-MG- 121

  Fly   113 ILPSDEALKFVSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKD 177
                  ..|..:...|:.||:|..::.|:          ..|:......:..|....|    :|:
Zfish   122 ------TTKKEARAKASELALKELLASLE----------NDEIPSDTDTVGPPPLPVR----EKE 166

  Fly   178 TPFTAMGAGRSKKEAKH-------AAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNA 235
            :..|.:.:||:..|.|:       :..|.:..||:. ..||  .|..|.::....:....| ...
Zfish   167 STITQIHSGRAVIERKNPIKDQVPSVVREMFTKLMD-NYPE--FSGCGGTLAAFVMLSPTG-CEV 227

  Fly   236 NATGGGDASDKTVGNPIG 253
            .|.|.|.::.|....|.|
Zfish   228 VALGTGSSNTKASPAPTG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 11/74 (15%)
DSRM 250..316 CDD:238007 2/4 (50%)
DSRM 394..460 CDD:214634
adad1NP_001277142.1 dsrm 74..139 CDD:278464 21/74 (28%)
A_deamin 229..549 CDD:280326 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.