DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and blanks

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster


Alignment Length:265 Identity:49/265 - (18%)
Similarity:91/265 - (34%) Gaps:70/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LPSDEALKFVSETDANG------------------LAMKTPVSILQELLSRRGITPGYELVQIEG 160
            :..|::...:::...||                  :..|..:.:|.||   :|:|  .:.:||: 
  Fly    82 IADDKSSDVITDDATNGRKKQKKNKKAKIRPLTMPVTSKDALMVLNEL---KGVT--VDNMQIK- 140

  Fly   161 AIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLP----------ESPSS 215
            ..||.....||....|  .:.|.|:  |...|::||....:.:::..::.          ||...
  Fly   141 RDHEGKIMARVVVNSK--KYEAEGS--SVNSARNAACEKALQEILTTKMKAVLDGPGKSLESDED 201

  Fly   216 SAGPSVTGLTVAGSGGDGNAN----ATGGGDASDK--TVGNPIGWLQEM------CMQRRW--PP 266
            .....:....:...|.:...:    ||...|..:|  :|..|...|.|.      ||...:  |.
  Fly   202 DILEKMASYAIHKLGEEWKTDDIDVATLYNDLKNKQTSVVEPKKPLPETWKNMHPCMVLNYMRPQ 266

  Fly   267 PSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRLQETPIDSGKISDSIC 331
            .::......|......|:::..:.|.....:|.|||.|:.                  |:|..:|
  Fly   267 CTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAARY------------------KLSALVC 313

  Fly   332 GELEG 336
            .:|.|
  Fly   314 NKLFG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 18/67 (27%)
DSRM 250..316 CDD:238007 14/73 (19%)
DSRM 394..460 CDD:214634
blanksNP_647966.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.