DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and ilf3a

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001025236.1 Gene:ilf3a / 324431 ZFINID:ZDB-GENE-030131-3151 Length:820 Species:Danio rerio


Alignment Length:260 Identity:71/260 - (27%)
Similarity:104/260 - (40%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GQRHVKLKKEKISAQVAQLSQPGQLQLSDVGDPAL-AGGSGLQGGVGLMGVILPSDEALKFVSET 126
            ||.:..|..::::::.|::.:      ..|.||.: .......||        ..|..|||..:.
Zfish   404 GQLYKVLGMDRLTSKAARMIE------HRVPDPPIKRPRESFDGG--------DFDTRLKFPRKE 454

  Fly   127 DANGLAMKTPVSILQELLSRRGITPG--YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSK 189
            :     .|.|.:.|.:|...|   ||  |:|....|..|||.|...|....    .|....|.||
Zfish   455 E-----RKEPPNALMKLNQLR---PGTVYKLASQTGPEHEPQFSMTVEVDG----VTYEATGPSK 507

  Fly   190 KEAK-HAAARALIDKLIGAQLP-------ESPSSSAG-PSVTGLTV-AGSGGDGNANATGGGDAS 244
            :.|| |.|.:.|:  .:|..||       |..|.|.. |:.|..:. ..:|.|..|.   ||...
Zfish   508 RSAKLHVAQKVLV--ALGVPLPSETKPAEEKKSQSVSTPAATASSENTPTGSDDGAE---GGPIL 567

  Fly   245 DKTVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA 309
            .|...||:..|.|   :||  ...||..:..|..:::.|||...:...:..|.|.:||:||..||
Zfish   568 TKHGKNPVMELNE---KRR--SLKYELVSVKGRFNDKTFTIEVDVDGQKFQGSGSNKKLAKANAA 627

  Fly   310  309
            Zfish   628  627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 23/70 (33%)
DSRM 250..316 CDD:238007 20/60 (33%)
DSRM 394..460 CDD:214634
ilf3aNP_001025236.1 DZF 165..418 CDD:295427 3/13 (23%)
DSRM 459..523 CDD:214634 23/72 (32%)
DSRM 572..>622 CDD:214634 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.