Sequence 1: | NP_609646.1 | Gene: | loqs / 34751 | FlyBaseID: | FBgn0032515 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997764.1 | Gene: | ilf3b / 321868 | ZFINID: | ZDB-GENE-030131-587 | Length: | 833 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 53/195 - (27%) |
---|---|---|---|
Similarity: | 78/195 - (40%) | Gaps: | 34/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 PVSILQELLSRRGITPG--YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAK-HAAA 197
Fly 198 RAL------------------IDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDAS 244
Fly 245 DKTVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA 309
Fly 310 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
loqs | NP_609646.1 | DSRM | 136..204 | CDD:214634 | 23/88 (26%) |
DSRM | 250..316 | CDD:238007 | 21/60 (35%) | ||
DSRM | 394..460 | CDD:214634 | |||
ilf3b | NP_997764.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 65..86 | ||
DZF | 90..344 | CDD:128842 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 339..403 | 53/195 (27%) | |||
DSRM | 406..470 | CDD:214634 | 21/67 (31%) | ||
DSRM | 529..>575 | CDD:214634 | 15/50 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 597..651 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 702..762 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 775..833 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170594045 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |