DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and ilf3b

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_997764.1 Gene:ilf3b / 321868 ZFINID:ZDB-GENE-030131-587 Length:833 Species:Danio rerio


Alignment Length:195 Identity:53/195 - (27%)
Similarity:78/195 - (40%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PVSILQELLSRRGITPG--YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAK-HAAA 197
            |...:..|:....:.||  |:|:...|.:|.|.|...|....|:  |.|  :|.||:.|| |.|.
Zfish   403 PAQAMNALMRLNQLKPGLQYKLISQTGPVHVPVFTMSVEVDGKN--FEA--SGPSKRTAKLHVAV 463

  Fly   198 RAL------------------IDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDAS 244
            :.|                  :|:.:.||....|.....|....:|...:    :.||...|...
Zfish   464 KVLQDMGLPTGMDQKTTELMKVDEPVSAQETLPPVIKMEPEPVPITETPT----DENARQQGPIL 524

  Fly   245 DKTVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAA 309
            .|...||:..|.|   :||  ...||..:|.|..|::.|.:...|...:..|.|.:||:||..||
Zfish   525 TKHGKNPVMELNE---KRR--GLKYELISETGGSHDKRFVMEVEIDGQKFQGTGSNKKVAKAYAA 584

  Fly   310  309
            Zfish   585  584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 23/88 (26%)
DSRM 250..316 CDD:238007 21/60 (35%)
DSRM 394..460 CDD:214634
ilf3bNP_997764.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..86
DZF 90..344 CDD:128842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..403 53/195 (27%)
DSRM 406..470 CDD:214634 21/67 (31%)
DSRM 529..>575 CDD:214634 15/50 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 597..651
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 702..762
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 775..833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.