DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Adar

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001368969.1 Gene:Adar / 31130 FlyBaseID:FBgn0026086 Length:681 Species:Drosophila melanogaster


Alignment Length:313 Identity:76/313 - (24%)
Similarity:113/313 - (36%) Gaps:77/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKK----EAKH 194
            |..|::|.||  |.|:.  |:|....|.:|.|.|...|....:    ..:|.|||||    ||..
  Fly   105 KNTVAMLNEL--RHGLI--YKLESQTGPVHAPLFTISVEVDGQ----KYLGQGRSKKVARIEAAA 161

  Fly   195 AAARALIDKLIGAQLPESPSSSAG-------------PSVTGLTVAGSGGDGNANATGGGDASDK 246
            .|.|:.|....||.|  ||...||             .|.:.:||     ||.......|     
  Fly   162 TALRSFIQFKDGAVL--SPLKPAGNLDFTSDEHLENDVSKSAITV-----DGQKKVPDKG----- 214

  Fly   247 TVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHR 311
                |:..|.|:     :...::|.....|..:...|.:..:|...:..|.|.|||.||..||..
  Fly   215 ----PVMLLYEL-----FNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKTAKNAAAKA 270

  Fly   312 MWMRLQETPIDSGKISDSICGELEGEPRSSENYYGELKDISVPTLTTQHSNKVSQFHKTLKNATG 376
            ...              |:| .:...|.....     |::.:|......|.::.|.|   .:..|
  Fly   271 ALA--------------SLC-NISYSPMVVPQ-----KNVPLPIDDKSSSMELPQIH---ADTIG 312

  Fly   377 KKLLKLQKTCLKNNKIDYIK---LLGEIATEN----QFEVTYVDIEEKTFSGQ 422
            :.:|:.....:|..:. |.:   |.|.:.|||    :.:|..|....|..||:
  Fly   313 RLVLEKFMEVIKGQEA-YSRRKVLAGIVMTENMNFCEAKVISVSTGTKCVSGE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 24/71 (34%)
DSRM 250..316 CDD:238007 16/65 (25%)
DSRM 394..460 CDD:214634 11/36 (31%)
AdarNP_001368969.1 DSRM_STRBP_RED-like_rpt1 105..167 CDD:380694 24/69 (35%)
DSRM_SF 213..>259 CDD:412133 10/59 (17%)
ADEAMc 306..677 CDD:214718 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.