DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Adad1

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_006232340.1 Gene:Adad1 / 294979 RGDID:1359309 Length:636 Species:Rattus norvegicus


Alignment Length:187 Identity:38/187 - (20%)
Similarity:70/187 - (37%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PVKGA------PLGQRHVKLKKEKISAQVAQLSQPGQLQLSDVGDPALAGGSGLQGGVGLMGVIL 114
            ||:.:      |.|..........::::|.|::       .:..:|.|:.|..     .:...:|
  Rat    67 PVQSSAQTVTLPTGYSSESCSLSNMASKVTQVT-------GNFPEPLLSKGLS-----SISNPVL 119

  Fly   115 PSDEALK-FVSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRF-----RVSF 173
            |..:..| |:.:.....:   .|||.|.:....:.:....:.....|.:..|.|.|     .:.:
  Rat   120 PPKKIPKEFIMKYRRGEI---NPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQY 181

  Fly   174 KDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLPE--------SPSSSAGPSVT 222
            |        .|.|::|||::..||:..:|:|:....||        .|...|.|.||
  Rat   182 K--------TGLGQNKKESRSNAAKLALDELLQLDEPEPRALEPAGPPPIPAEPIVT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 17/72 (24%)
DSRM 250..316 CDD:238007
DSRM 394..460 CDD:214634
Adad1XP_006232340.1 DSRM 139..204 CDD:214634 17/72 (24%)
A_deamin 291..611 CDD:280326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.