DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Adad1

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_033376.2 Gene:Adad1 / 21744 MGIID:103258 Length:619 Species:Mus musculus


Alignment Length:234 Identity:48/234 - (20%)
Similarity:80/234 - (34%) Gaps:70/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FHGSSLPQQLQ----NLHIQPQQASPNPVQTGFAPRRHYNNLVGLGNGNAVSGSPVKGAPLGQRH 66
            |..|.:|...|    ||.:||.      .||...|..:.:....|.|                  
Mouse    50 FQSSRVPSFAQMLKKNLPVQPS------AQTVTLPTGYSSESCSLSN------------------ 90

  Fly    67 VKLKKEKISAQVAQLSQPGQLQLSDVGDPALAGGSGLQGGVGLMGVILPSDEALKFVSETDANGL 131
                   ::::|.|::       .:..:|.|:.|........|....||.:..:|: ...:.|  
Mouse    91 -------MASKVTQVT-------GNFPEPLLSKGLSSISNPVLPPKKLPKEFIMKY-KRGEIN-- 138

  Fly   132 AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRF-----RVSFKDKDTPFTAMGAGRSKKE 191
                |||.|.:....:.:....:.....|.:..|.|.|     .:.:|        .|.|::|||
Mouse   139 ----PVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYK--------TGLGQNKKE 191

  Fly   192 AKHAAARALIDKLIGAQLPE--------SPSSSAGPSVT 222
            ::..||:..:|:|:....||        .|...|.|.||
Mouse   192 SRSNAAKLALDELLQLDEPEPRVLEPAGPPPIPAEPVVT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 17/72 (24%)
DSRM 250..316 CDD:238007
DSRM 394..460 CDD:214634
Adad1NP_033376.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 48/234 (21%)
DSRM 139..204 CDD:214634 17/72 (24%)
ADEAMc 246..618 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.