DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and Ilf3

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_011240705.1 Gene:Ilf3 / 16201 MGIID:1339973 Length:916 Species:Mus musculus


Alignment Length:205 Identity:57/205 - (27%)
Similarity:84/205 - (40%) Gaps:28/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PVSILQELLSRRGITPG--YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAK-HAAA 197
            |...:..|:....:.||  |:|:...|.:|.|.|...|.....:  |.|  :|.|||.|| |.|.
Mouse   417 PPQAMNALMRLNQLKPGLQYKLISQTGPVHAPIFTMSVEVDGSN--FEA--SGPSKKTAKLHVAV 477

  Fly   198 RALIDKLI--GAQLPES-------------PSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKT 247
            :.|.|..:  ||:..:|             |:..|.|.|.......|....:...|..|....|.
Mouse   478 KVLQDMGLPTGAEGRDSSKGEDSAEESDGKPAIVAPPPVVEAVSNPSSVFPSDATTEQGPILTKH 542

  Fly   248 VGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRM 312
            ..||:..|.|   :||  ...||..:|.|..|::.|.:...:...:..|.|.:||:||..||...
Mouse   543 GKNPVMELNE---KRR--GLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAA 602

  Fly   313 WMRL-QETPI 321
            ..:| .:||:
Mouse   603 LEKLFPDTPL 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 23/70 (33%)
DSRM 250..316 CDD:238007 20/65 (31%)
DSRM 394..460 CDD:214634
Ilf3XP_011240705.1 DZF 106..360 CDD:128842
DSRM_ILF3_rpt1 416..488 CDD:380739 23/74 (31%)
DSRM_ILF3_rpt2 538..609 CDD:380741 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.