Sequence 1: | NP_609646.1 | Gene: | loqs / 34751 | FlyBaseID: | FBgn0032515 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240705.1 | Gene: | Ilf3 / 16201 | MGIID: | 1339973 | Length: | 916 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 84/205 - (40%) | Gaps: | 28/205 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 PVSILQELLSRRGITPG--YELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAK-HAAA 197
Fly 198 RALIDKLI--GAQLPES-------------PSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKT 247
Fly 248 VGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRM 312
Fly 313 WMRL-QETPI 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
loqs | NP_609646.1 | DSRM | 136..204 | CDD:214634 | 23/70 (33%) |
DSRM | 250..316 | CDD:238007 | 20/65 (31%) | ||
DSRM | 394..460 | CDD:214634 | |||
Ilf3 | XP_011240705.1 | DZF | 106..360 | CDD:128842 | |
DSRM_ILF3_rpt1 | 416..488 | CDD:380739 | 23/74 (31%) | ||
DSRM_ILF3_rpt2 | 538..609 | CDD:380741 | 22/75 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167848547 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |