DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loqs and ADAD2

DIOPT Version :9

Sequence 1:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_631913.3 Gene:ADAD2 / 161931 HGNCID:30714 Length:665 Species:Homo sapiens


Alignment Length:272 Identity:67/272 - (24%)
Similarity:94/272 - (34%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQQLQNLHIQPQ----QASPNPVQTGFAPRRHYNNLVGLGNGNAVS----GSPVKGAPLGQRHVK 68
            |:...:|.|.||    :..|...|:.:.|..........|....||    ..|..||.:|:....
Human    17 PRLAASLQISPQPRPWRPLPAQAQSAWGPAPAPATYRAEGGWPQVSVLRDSGPGAGAGVGELGAA 81

  Fly    69 LKKEKISAQVAQLSQ----PGQLQLSDVGDPALAGGSGLQGGVGLMGVIL--------------- 114
            ...|.:..|:.:..:    |..|.|.....||....|.|......:|:.|               
Human    82 RAWENLGEQMGKAPRVPVPPAGLSLPLKDPPASQAVSLLTEYAASLGIFLLFREDQPPGKVFKYR 146

  Fly   115 -PSDEALK------------FVSETDANGL-------------AMKTPVSILQELLSRRGITPGY 153
             |..|.||            |:..|...||             |.:.|..::.|:.||   .|  
Human   147 APGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESR---IP-- 206

  Fly   154 ELVQIEGAIHE--PTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQL--PESPS 214
                   |:.|  |.|.|.|| .:.|......|...||.|||..||.:.: ..|.:||  ||||.
Human   207 -------AVEELGPCFPFSVS-AELDGVVCPAGTANSKTEAKQQAALSAL-CYIRSQLENPESPQ 262

  Fly   215 SSAGPSVTGLTV 226
            :|:.|.:..|:|
Human   263 TSSRPPLAPLSV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 21/69 (30%)
DSRM 250..316 CDD:238007
DSRM 394..460 CDD:214634
ADAD2NP_631913.3 dsrm <217..251 CDD:278464 12/35 (34%)
A_deamin 343..658 CDD:280326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.