DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and EPS1

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_012261.1 Gene:EPS1 / 854812 SGDID:S000001267 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:46/175 - (26%)
Similarity:68/175 - (38%) Gaps:49/175 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 VKFFSNGVFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDDDNFSSTLKRK 413
            |.|||...|..:..:..|        :|.|..|.|                 |:..||...|.:.
Yeast    10 VTFFSCITFLLKFTIAAA--------EPPEGFPEP-----------------LNPTNFKEELSKG 49

  Fly   414 KHALVMFYAPWCGHCKHTKP-------EFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYP 471
            .| ::.||:|:|.||||..|       ||...:..|    .|.|..::|.:.|.||...|:..:|
Yeast    50 LH-IIDFYSPYCPHCKHLAPVWMETWEEFKEESKTL----NITFSQVNCIESADLCGDENIEYFP 109

  Fly   472 TILYFS---YLKTKLDYNGGRTSKDFIAYM-------NNPPTSAD 506
            .|..::   |:|:..:  ..||.:..||:.       ||..|..|
Yeast   110 EIRLYNPSGYIKSFTE--TPRTKESLIAFARRESMDPNNLDTDLD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 42/167 (25%)
PDI_a_PDIR 272..373 CDD:239295 6/23 (26%)
PDI_a_PDIR 397..498 CDD:239295 32/110 (29%)
EPS1NP_012261.1 Thioredoxin 33..139 CDD:395038 34/129 (26%)
PTZ00102 <404..>472 CDD:240266
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.