DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and TRX1

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_013144.1 Gene:TRX1 / 850732 SGDID:S000004033 Length:103 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:30/94 - (31%)
Similarity:46/94 - (48%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKY 341
            |:..|:.|:..:|..:|.|||.|||.||.:.|..||.:.:..|..    ...||..:...:|:|.
Yeast     7 TASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQAD----FYKLDVDELGDVAQKN 67

  Fly   342 KVKGYPTVKFFSNGVFKFEVNVREASKIV 370
            :|...||:..|.||        :|.:|:|
Yeast    68 EVSAMPTLLLFKNG--------KEVAKVV 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 30/94 (32%)
PDI_a_PDIR 272..373 CDD:239295 30/94 (32%)
PDI_a_PDIR 397..498 CDD:239295
TRX1NP_013144.1 thioredoxin 6..103 CDD:200072 30/94 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.