DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Pdia6l1

DIOPT Version :10

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001102929.1 Gene:Pdia6l1 / 685171 RGDID:1597712 Length:139 Species:Rattus norvegicus


Alignment Length:59 Identity:25/59 - (42%)
Similarity:35/59 - (59%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 PEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLD-YNGGRT 490
            ||:..|||.|:|   :...|:|..:..:|..:|.|:|:|||..|...|||.: |.||||
  Rat     4 PEWKKAATVLRD---VKVRAVDAGRHQSLGDQYGVQGFPTIKIFGASKTKPEYYQGGRT 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295 25/59 (42%)
Pdia6l1NP_001102929.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold <2..68 CDD:469754 25/59 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.