DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Dnajc10

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_077143.2 Gene:Dnajc10 / 66861 MGIID:1914111 Length:793 Species:Mus musculus


Alignment Length:482 Identity:110/482 - (22%)
Similarity:184/482 - (38%) Gaps:139/482 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EYKDFKKLLRTKNNVLALY-VTSAKSAAAELKIFREAAEAIRGTGTMLLLDCGQQDRKKLCKKLK 94
            |.|..|.||:.::..:..: .:||....::|.:|:......:|.||                   
Mouse   383 ELKKLKTLLKNEHIQVGRFDCSSAPGICSDLYVFQPCLAVFKGQGT------------------- 428

  Fly    95 VSPDPYAIKHYKDGDFHKDYDRQLSVSSMITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTK--- 156
               ..|.|.|                                     ||.:|:  |..:|.|   
Mouse   429 ---KEYEIHH-------------------------------------GKKILY--DILAFAKESV 451

  Fly   157 --HL---------RKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENA 210
              |:         ..|..|.||.|:.|||..|:.:.||..||||.|  .|...:..::....|. 
Mouse   452 NSHVTTLGPQNFPASDKEPWLVDFFAPWCPPCRALLPELRKASTLL--YGQLKVGTLDCTIHEG- 513

  Fly   211 PIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSF---MLNPNAKPTPKPKEPEWSADTNSE 272
             :..|:||..:||.:.|....:. .|||.::.|.::.|   :.||:                   
Mouse   514 -LCNMYNIQAYPTTVVFNQSSIH-EYEGHHSAEQILEFIEDLRNPS------------------- 557

  Fly   273 IVHLTSQGFEPALKDEKSA---LVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLL--AALDAT 332
            :|.||...|...:|..|..   :|.||:|||..|:.:.||:::.|     :.:.||:  .::|..
Mouse   558 VVSLTPSTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMA-----RTLTGLINVGSVDCQ 617

  Fly   333 KEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEF------MRDPKEPPPPPPPEKSWEE 391
            :..|...:..|:.||.::|:.          :::||..::      .||...       .:||..
Mouse   618 QYHSFCTQENVQRYPEIRFYP----------QKSSKAYQYHSYNGWNRDAYS-------LRSWGL 665

  Fly   392 EEDSKEVLFLDDDNFS-STLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDC 455
            ....:..:.|....|: ..|:.|.|.:|.|||||||.|::..|||...|..::...|..  .:||
Mouse   666 GFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAG--KVDC 728

  Fly   456 TKLAALCAKYNVRGYPTILYFSYLKTK 482
            ......|.|..::.||::..:.|.:.|
Mouse   729 QAYPQTCQKAGIKAYPSVKLYQYERAK 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 15/100 (15%)
PDI_a_PDIR 144..249 CDD:239295 34/121 (28%)
ER_PDI_fam 166..500 CDD:273457 86/332 (26%)
PDI_a_PDIR 272..373 CDD:239295 26/111 (23%)
PDI_a_PDIR 397..498 CDD:239295 27/87 (31%)
Dnajc10NP_077143.2 DnaJ 34..>132 CDD:223560
DnaJ 35..97 CDD:278647
PDI_a_ERdj5_N 129..229 CDD:239301
ER_PDI_fam 130..551 CDD:273457 51/233 (22%)
Trxb 1 235..350
Trxb 2 348..463 22/140 (16%)
PDI_a_ERdj5_C 453..550 CDD:239302 29/101 (29%)
PDI_a_ERdj5_C 556..663 CDD:239302 29/147 (20%)
PDI_a_ERdj5_C 670..775 CDD:239302 27/88 (31%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.