DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and qsox2

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_009300239.1 Gene:qsox2 / 559603 ZFINID:ZDB-GENE-110203-4 Length:656 Species:Danio rerio


Alignment Length:110 Identity:35/110 - (31%)
Similarity:52/110 - (47%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PEKSWEEEEDSKEVLFLDDDNFSSTLKRKKHA-LVMFYAPWCGHCKHTKPEFTAAATALQD-DPR 447
            |.:.:.||:   .|:.|..|:...|:.....| ||.||:.|||||....|.:.|.|..::| ...
Zfish    22 PARLYTEED---PVVILSSDSLKQTVLNSSSAWLVQFYSSWCGHCIQYSPTWKALAGDVKDWAQA 83

  Fly   448 IAFVAIDCT--KLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRT 490
            |....:||.  |...:|.::.:..|||..||....|..|:  |:|
Zfish    84 IRIGVVDCAHEKNFDICKEFGIHFYPTFRYFKAHDTTNDF--GKT 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 35/110 (32%)
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295 32/98 (33%)
qsox2XP_009300239.1 PDI_a_QSOX 30..141 CDD:239290 32/102 (31%)
Evr1_Alr 403..499 CDD:282612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.