DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and tmx3a

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001018393.2 Gene:tmx3a / 553578 ZFINID:ZDB-GENE-050522-396 Length:437 Species:Danio rerio


Alignment Length:206 Identity:53/206 - (25%)
Similarity:86/206 - (41%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNI 218
            ||:..:.::  .||.||.|||.:|...:|.:.:...|||:.|..:... .::...:..|...|||
Zfish    30 FTEFRQNEL--WLVEFYAPWCAYCHTFEPVWTEVGAELKSLGSPVNVG-KIDTTAHTSIATEFNI 91

  Fly   219 TGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTS-QGFE 282
            .|:||:..|: |.|.|.|:|...|:.::.| .|..:.|..:|               |:| |.|:
Zfish    92 RGYPTIKLFK-GDLSFDYKGPRTKDGIIEF-TNRVSGPVVRP---------------LSSVQLFQ 139

  Fly   283 PALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEK-YKVKGY 346
            ..:.......|     :.|....:|.||.|||.|.       ::.....|....|..| ..::..
Zfish   140 HVMSRHDVIFV-----YIGGESLLKKEYYKAATEF-------IVHTYFFTASEEILPKAVTLQDV 192

  Fly   347 PTVKFFSNGVF 357
            |.|..|.:|.:
Zfish   193 PAVAVFKDGTY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295 29/94 (31%)
ER_PDI_fam 166..500 CDD:273457 51/194 (26%)
PDI_a_PDIR 272..373 CDD:239295 20/88 (23%)
PDI_a_PDIR 397..498 CDD:239295
tmx3aNP_001018393.2 PDI_a_TMX3 22..125 CDD:239298 31/99 (31%)
Thioredoxin_6 155..332 CDD:290560 14/56 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.