Sequence 1: | NP_609645.2 | Gene: | CG9302 / 34750 | FlyBaseID: | FBgn0032514 | Length: | 510 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018393.2 | Gene: | tmx3a / 553578 | ZFINID: | ZDB-GENE-050522-396 | Length: | 437 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 34/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 FTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNI 218
Fly 219 TGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTS-QGFE 282
Fly 283 PALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEK-YKVKGY 346
Fly 347 PTVKFFSNGVF 357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9302 | NP_609645.2 | PDI_b_PDIR_N | 24..131 | CDD:239365 | |
PDI_a_PDIR | 144..249 | CDD:239295 | 29/94 (31%) | ||
ER_PDI_fam | 166..500 | CDD:273457 | 51/194 (26%) | ||
PDI_a_PDIR | 272..373 | CDD:239295 | 20/88 (23%) | ||
PDI_a_PDIR | 397..498 | CDD:239295 | |||
tmx3a | NP_001018393.2 | PDI_a_TMX3 | 22..125 | CDD:239298 | 31/99 (31%) |
Thioredoxin_6 | 155..332 | CDD:290560 | 14/56 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |