DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and TMX3

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_061895.3 Gene:TMX3 / 54495 HGNCID:24718 Length:454 Species:Homo sapiens


Alignment Length:248 Identity:63/248 - (25%)
Similarity:104/248 - (41%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 QGF----EPALKDEKSA---LVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPS 336
            :||    :.:.|:.::.   ||.||||||||||:::|.:.:..||||....|..:..:|||...|
Human    25 KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSS 89

  Fly   337 IAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFL 401
            ||.::.|:||||:|.....:.......|....|:||..........|.|.:...|....:..:|.
Human    90 IASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFF 154

  Fly   402 DDDNFSSTLKRK---KHALVMFYAPWCGHCKHTKPEFTA-----AATALQDDPRIAFVAIDCTKL 458
            ......|.||.|   ..:.::.|..:....:...||:..     |....:|:....:...:...|
Human   155 VYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDL 219

  Fly   459 AALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSK-DFIAYMNNPPTSADRTEL 510
            ::...:...:.|..:..|      |.|..|.|.| ..:|.::...||.:.|.|
Human   220 SSWINRERFQNYLAMDGF------LLYELGDTGKLVALAVIDEKNTSVEHTRL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 59/236 (25%)
PDI_a_PDIR 272..373 CDD:239295 36/100 (36%)
PDI_a_PDIR 397..498 CDD:239295 19/109 (17%)
TMX3NP_061895.3 PDI_a_TMX3 27..130 CDD:239298 36/102 (35%)
ER_PDI_fam 29..>346 CDD:273457 61/244 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..454
Di-lysine motif 451..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.