DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and l(2)01289

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster


Alignment Length:596 Identity:117/596 - (19%)
Similarity:207/596 - (34%) Gaps:192/596 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VQDDIAEY-----KDFKKLLRTK----NNVLALYVTSAK--SAAAELKIFREAAEAIRGTGTMLL 78
            :.|:.|||     |...||:..|    |.....|....|  :...::....|..:.:.....|.:
  Fly  1060 IDDEAAEYGIYIVKMHDKLMAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWLTSPANMEM 1124

  Fly    79 LDCGQQDRKKLCKKLKVSPDPYAIKHYKDG-----------------------DFHKDYDRQL-- 118
            .|..:|..:|:.:|::.:.|..|:..|.|.                       ||.|..|:|:  
  Fly  1125 TDHIEQVNRKMFEKIRKNSDYVAVIFYSDECKQCPRVLAEVEHIDDEADKAGIDFVKIDDKQMAK 1189

  Fly   119 -----SVSSMITF---MRDP---SGDLPWEE----------DPAGKDVLHFSDAASFTKHLRKDI 162
                 ::.:::.|   .::|   :|||..||          ||:| ||:...:..... ||.::.
  Fly  1190 EYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQKDPSG-DVIEDLEGERLV-HLIEES 1252

  Fly   163 RPMLVMFYVPW----CGFCKK---MKPEYGKASTELKTKGGYILAAMNVERQ-----------EN 209
            ..:.|.|   |    |..|..   .|....|...:.:.:||...||.....:           |:
  Fly  1253 GSIAVYF---WNKTKCDICNSKAARKARLKKERDQHQQEGGAASAAAAFGSEADPSEAAAGGAED 1314

  Fly   210 AP-------------------------------------IRKMFNITG----------------- 220
            ||                                     :.::.||..                 
  Fly  1315 APAAGSEGDSPPASAAAPADASTGKQEDDADGCEQCTKVLEELENIDDDCDKHGITFVKTRDFSV 1379

  Fly   221 --------FPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEPEW--SADTNSEIVH 275
                    :|.|:|||.| :...:|||.::|..|.                :|  :..|...|..
  Fly  1380 ADGYGVHEYPALVYFEGG-IPNVFEGELSEEEEVL----------------QWLITQKTEDRIEL 1427

  Fly   276 LTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEK 340
            :|.|..|..:::.:...|.||...|..|.::     ...||:...:.......:...::|.:|::
  Fly  1428 ITRQMLETMVEETQYLAVYFYKINCNICDQI-----LEGLELIDDECDVFGIHMVKIQDPQLAKR 1487

  Fly   341 YKVKGYPTVKFFSNG-VFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSKEV--LFLD 402
            |.:|.:|.:.:|.|| ...||.:::....::|::.|          :.:.|..::.:||  ..||
  Fly  1488 YSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLID----------DDNRELADEIEEVNERMLD 1542

  Fly   403 DDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCA--KY 465
            .....|||     .:|.||...|..|:....|..      :.|.......||..|:|::.|  ||
  Fly  1543 RLMAESTL-----LVVFFYDDDCAECEEILEELE------EIDGEADMFGIDFVKIASIQAAKKY 1596

  Fly   466 NVRGYPTILYF 476
            .:...|:::||
  Fly  1597 EIVNIPSLVYF 1607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 28/152 (18%)
PDI_a_PDIR 144..249 CDD:239295 31/184 (17%)
ER_PDI_fam 166..500 CDD:273457 77/398 (19%)
PDI_a_PDIR 272..373 CDD:239295 22/101 (22%)
PDI_a_PDIR 397..498 CDD:239295 24/84 (29%)
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259 19/96 (20%)
TRX_family 1433..>1502 CDD:239245 14/73 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.