DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and CG11790

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:92/223 - (41%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 MLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFEN 229
            ::|:|....|..|    .||....|:::.:....|:|:.|:..::..: .:::.:..|.|::|..
  Fly    40 VVVLFNKNNCQRC----VEYENMVTKIRAQLEETLSAIVVQSVDSNLV-SIYDPSKEPALVFFRR 99

  Fly   230 GKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVM 294
            | :...|.||.|.:.::.| .|.|.:|..|.     .:|.|.|  |||.........|   ..:.
  Fly   100 G-IPILYHGEINDDEILDF-FNDNLEPAVKE-----LSDDNFE--HLTQASSGATTGD---WFIF 152

  Fly   295 FYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNG-VFK 358
            |.:..|..|:|:...:|....::|:|.....:.:|::  ..|.|.:..|...|...|...| ::|
  Fly   153 FSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLES--GISTATRLGVLEAPAFIFLRQGKMYK 215

  Fly   359 FEVNVREASKIVEFMR---DPKEPPPPP 383
            :..........|:|..   ....|.|.|
  Fly   216 YSAKQYSPEAFVQFAEKGYTQSHPQPVP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295 18/83 (22%)
ER_PDI_fam 166..500 CDD:273457 50/222 (23%)
PDI_a_PDIR 272..373 CDD:239295 21/101 (21%)
PDI_a_PDIR 397..498 CDD:239295
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.