DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and CG10029

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_649716.1 Gene:CG10029 / 40883 FlyBaseID:FBgn0037498 Length:410 Species:Drosophila melanogaster


Alignment Length:240 Identity:58/240 - (24%)
Similarity:99/240 - (41%) Gaps:51/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 NSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPG----LLAALD 330
            ||.:|.:|.:..:..:...:..|:.||..||...:.::|.:|:||.::.| |.|.    :|..::
  Fly    26 NSSVVAVTHENLQGIIDSNELVLLSFYTDWCRFSQILQPIFEEAAAKVIQ-KFPENGRVILGKVN 89

  Fly   331 ATKEPSIAEKYKVKGYPTVKFFSNGV-----FKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWE 390
            ...|..:|:::.:..|||:|...||:     ::.:.:|....:.||     ||...|        
  Fly    90 CDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVE-----KELSDP-------- 141

  Fly   391 EEEDSKEVLFLDDDNFSSTLKRKK--HALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAI 453
                .||...:||      ||...  :.:|:.|.....|.::  ..:...|:.|::|.|......
  Fly   142 ----IKEFHNIDD------LKNVDVGYGIVIGYFISKDHAEY--DNYRRVASLLRNDCRFLVGFG 194

  Fly   454 DCTKLAALCAKYNV--RGYPTI-----LYFSYLKTKLDYNGGRTS 491
            |.||......|..:  ||.|:|     .|..||       |..||
  Fly   195 DLTKDLRPPGKNALIFRGDPSIPNHKNQYSEYL-------GNMTS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 58/240 (24%)
PDI_a_PDIR 272..373 CDD:239295 26/109 (24%)
PDI_a_PDIR 397..498 CDD:239295 26/104 (25%)
CG10029NP_649716.1 PDI_a_ERp44 27..134 CDD:239294 25/107 (23%)
PDI_b_ERp44 142..237 CDD:239368 27/106 (25%)
Thioredoxin_6 165..352 CDD:290560 19/77 (25%)
PDI_b'_ERp44 248..357 CDD:239370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.