Sequence 1: | NP_609645.2 | Gene: | CG9302 / 34750 | FlyBaseID: | FBgn0032514 | Length: | 510 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998529.3 | Gene: | p4hb / 406673 | ZFINID: | ZDB-GENE-080610-1 | Length: | 509 | Species: | Danio rerio |
Alignment Length: | 450 | Identity: | 91/450 - (20%) |
---|---|---|---|
Similarity: | 125/450 - (27%) | Gaps: | 223/450 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 272 EIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPS 336
Fly 337 IAEKYKVKGYPTVKFFSNG---------------------------------------------- 355
Fly 356 -------------------------------------VF-KFEV--------------------- 361
Fly 362 ----------------------------------------------------------------- 361
Fly 362 ---------NVREASKIVEFMRDPKEPPP---------------PPPPEKSWE------------ 390
Fly 391 ------------EEEDSKEVLFLDDDNFSS-TLKRKKHALVMFYAPWCGHCKHTKPEFTAAATAL 442
Fly 443 QDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYF--SYLKTKLDYNGGRTSKDFIAYMNN 500 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9302 | NP_609645.2 | PDI_b_PDIR_N | 24..131 | CDD:239365 | |
PDI_a_PDIR | 144..249 | CDD:239295 | |||
ER_PDI_fam | 166..500 | CDD:273457 | 91/448 (20%) | ||
PDI_a_PDIR | 272..373 | CDD:239295 | 50/279 (18%) | ||
PDI_a_PDIR | 397..498 | CDD:239295 | 32/103 (31%) | ||
p4hb | NP_998529.3 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |