| Sequence 1: | NP_609645.2 | Gene: | CG9302 / 34750 | FlyBaseID: | FBgn0032514 | Length: | 510 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001034820.1 | Gene: | p4hb / 395048 | XenbaseID: | XB-GENE-494070 | Length: | 506 | Species: | Xenopus tropicalis |
| Alignment Length: | 450 | Identity: | 91/450 - (20%) |
|---|---|---|---|
| Similarity: | 130/450 - (28%) | Gaps: | 223/450 - (49%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 272 EIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPS 336
Fly 337 IAEKYKVKGYPTVKFFSNG--VFKFEVNV-REASKIVE--------------------------- 371
Fly 372 -----FMRDPKEPPPP------------------------------------------------- 382
Fly 383 ------------------------------------------PPPEKSWEEE-EDSKEV------ 398
Fly 399 ----LFLDDD------------------------------------------------------- 404
Fly 405 --------------------------NFSSTL-KRKKHALVMFYAPWCGHCKHTKPEFTAAATAL 442
Fly 443 QDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYF--SYLKTKLDYNGGRTSKDFIAYMNN 500 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9302 | NP_609645.2 | PDI_b_PDIR_N | 24..131 | CDD:239365 | |
| PDI_a_PDIR | 144..249 | CDD:239295 | |||
| ER_PDI_fam | 166..500 | CDD:273457 | 91/448 (20%) | ||
| PDI_a_PDIR | 272..373 | CDD:239295 | 48/135 (36%) | ||
| PDI_a_PDIR | 397..498 | CDD:239295 | 34/194 (18%) | ||
| p4hb | NP_001034820.1 | ER_PDI_fam | 25..474 | CDD:273457 | 91/449 (20%) |
| pdi_dom | 29..133 | CDD:273454 | 48/103 (47%) | ||
| PDI_b_family | 137..232 | CDD:239279 | 4/94 (4%) | ||
| PDI_b'_family | 244..347 | CDD:239280 | 8/102 (8%) | ||
| PDI_a_PDI_a'_C | 368..470 | CDD:239293 | 31/103 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||