DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and CG5554

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster


Alignment Length:185 Identity:42/185 - (22%)
Similarity:74/185 - (40%) Gaps:42/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 EPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLL 326
            |..|         ||..||         ..::.|:||||..||.:.|.:|:.|...|..::.  :
  Fly    43 EDNW---------HLMLQG---------EWMIEFFAPWCPACKNLAPTWERFARVAKDVQVQ--V 87

  Fly   327 AALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEE 391
            |.:|.|..||::.::.|...||:....:|.|:.....|:...::.|::  |:......|..:|::
  Fly    88 AKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVK--KQQWQSIEPLSAWKK 150

  Fly   392 EEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGH-CKHTKPEFTAAATALQDD 445
            .:.:                   |..|:.|.....| .|||:..|......||::
  Fly   151 PDTT-------------------HMSVLSYFFKLSHTLKHTQKLFKDFNGRLQEE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 42/185 (23%)
PDI_a_PDIR 272..373 CDD:239295 26/100 (26%)
PDI_a_PDIR 397..498 CDD:239295 10/50 (20%)
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 29/114 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.