DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Tmx1

DIOPT Version :10

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_006240240.1 Gene:Tmx1 / 362751 RGDID:1308455 Length:298 Species:Rattus norvegicus


Alignment Length:158 Identity:35/158 - (22%)
Similarity:64/158 - (40%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 NKEALVSFMLNPNAKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKR 305
            |.......::|...|.:|:.:|     ||           |:..|...|..:...|||||..|:.
  Rat    33 NSSVKAVVIINSYVKYSPRLQE-----DT-----------FKHFLLHCKCNIHKSYAPWCPACQN 81

  Fly   306 MKPEYEKAA-----LEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVRE 365
            ::||:|..|     ||:|       :|.:|.|::..::.::.:...|::....:|.|:..:..|.
  Rat    82 LQPEWESFAEWGEDLEVK-------VAKVDVTEQTGLSGRFIITALPSIYHCKDGEFRRYLGPRT 139

  Fly   366 ASKIVEFMRDPKEPPPPPPPEKSWEEEE 393
            ....:.|:           .||.|:..|
  Rat   140 KKDFINFI-----------SEKEWKNVE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295 1/7 (14%)
PDI_a_PDIR 272..373 CDD:239295 23/105 (22%)
PDI_a_PDIR 397..498 CDD:239295
Tmx1XP_006240240.1 PTZ00443 <70..242 CDD:185622 25/105 (24%)
Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold <70..149 CDD:469754 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.