DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and ERp60

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster


Alignment Length:512 Identity:121/512 - (23%)
Similarity:185/512 - (36%) Gaps:170/512 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MITFMRDPSGDLPWEEDPAGKDVLHFSD---AASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEY 184
            ::.|:...||        |.:|||...|   |.:..:|     ...|||||.||||.||::||||
  Fly    10 LLGFIAISSG--------AEQDVLELGDDDFATTLKQH-----ETTLVMFYAPWCGHCKRLKPEY 61

  Fly   185 GKASTELKTKGGYILAAMNVERQENAPIR--------------KMFNITGFPTLIYFENGKLRFT 235
            .||:              .:.:.::.||:              ..::::|:|||..|...::...
  Fly    62 AKAA--------------EIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQD 112

  Fly   236 YEGENNKEALVSFM---LNPNAKPTPKPKEPEWSADT---------------------------- 269
            |.|......:..:|   :.|.:|......|.:...||                            
  Fly   113 YNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNR 177

  Fly   270 -------NSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMK--------- 318
                   :||...|..||       |...:|:..||      .:..::|.::::.:         
  Fly   178 EKYRFGHSSEKEVLDKQG-------ETDKIVLIRAP------HLSNKFESSSIKFEGSSESDLST 229

  Fly   319 --QKKIPGLLA--ALDATKE---PSIAEKYKV---KGYPTVKFFSNGVFKF------EVNVREAS 367
              ::...||:.  ..|:.|:   |.|...|.|   |......::.|.|.|.      ::|...||
  Fly   230 FVKENFHGLVGHRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIAS 294

  Fly   368 ------------------KIVEFMRDPKEPPPPPPPEKSWEEEEDSKEVLFLDD----------- 403
                              |.|...||.|........|.|.|..:|..|.|..::           
  Fly   295 KDDFQHELNEYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIP 359

  Fly   404 ------------DNFSS-TLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDC 455
                        .||.. .:...|..|:.||||||||||...|.:...|..|||:. :|.|.:|.
  Fly   360 ESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDED-VAIVKMDA 423

  Fly   456 TKLAALCAKYNVRGYPTILYF-SYLKTK-LDYNGGRTSKDFIAYMNNPPTSADRTEL 510
            | ...:..::||||:||:.:. ...|.| :.|||||...||:.|:....|    |||
  Fly   424 T-ANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEAT----TEL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 1/7 (14%)
PDI_a_PDIR 144..249 CDD:239295 32/121 (26%)
ER_PDI_fam 166..500 CDD:273457 107/454 (24%)
PDI_a_PDIR 272..373 CDD:239295 26/143 (18%)
PDI_a_PDIR 397..498 CDD:239295 40/126 (32%)
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 117/491 (24%)
PDI_a_PDIR 23..126 CDD:239295 32/121 (26%)
PDI_b_ERp57 133..235 CDD:239367 14/114 (12%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 23/105 (22%)
PDI_a_PDI_a'_C 365..467 CDD:239293 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.