DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and CG18132

DIOPT Version :10

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster


Alignment Length:94 Identity:25/94 - (26%)
Similarity:40/94 - (42%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 VLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALC 462
            :|.|..|||..|.:.... .|.||.|.|..|...:..:|..|.:.:....|.|..::|.....:|
  Fly    52 ILKLRVDNFFETTEDGTF-FVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTIC 115

  Fly   463 AKYNVRGYPTILYFSYLKTKLDYNGGRTS 491
            ..|.:|..|.:::....:....|:|..||
  Fly   116 NDYELRYEPNLIWLENGEEVQQYDGDLTS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295 25/94 (27%)
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.