DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and CG18130

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:429 Identity:83/429 - (19%)
Similarity:131/429 - (30%) Gaps:165/429 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AKSKTSAVQDDIAEYKDFKKLLRTKNNVLALYVTSAKSAAAELKIFREAAE-----------AIR 71
            :|:||.::..:.|..                    |:..||:|....||:|           |:.
  Fly   325 SKAKTKSISHEEAHL--------------------AEEEAADLDAEEEASEEETVMPEPGGDAMG 369

  Fly    72 GTGTMLLLDCGQQDRKKLCKKLKVSP------DPYAIKHYKDGDFHKDYDRQLSVSS-------- 122
            |..:|...:            |::.|      |...::..|:.:..|...|..:|..        
  Fly   370 GLPSMPGFE------------LEIEPVDEAGEDEEEVQEIKEEEPSKPLTRTKTVKMPPIWVPNS 422

  Fly   123 --------MITFMRDPSGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFY--VPWCGFC 177
                    .:.|....||.||.:..|....|:...||:.     ||:|..::....  ||..||.
  Fly   423 RRTHAALIYVFFRGQTSGFLPPDPKPEPPHVIMAFDASK-----RKEIMHVIDRHKDDVPLYGFF 482

  Fly   178 KKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNK 242
            ...:|:..:            |.|.:.::.|::|......|.            |:......|..
  Fly   483 SSAEPDEAE------------LIATSTDKYESSPHSSGDKIV------------LKVNKVQSNMM 523

  Fly   243 EALVSF---MLNPNA--------KPTPKPKEPEWSADTNSEIVHLTSQGFEPALKDEKSALVMFY 296
            .:|||:   .::||.        |..|:..:|:      .|:|      .|...|.:||      
  Fly   524 LSLVSYGPSYVSPNVTVGKDEALKFFPEDYKPQ------EEVV------VEVEKKKKKS------ 570

  Fly   297 APWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEV 361
                           |.|.|:.|:......||..|...||.|.               ...:.|.
  Fly   571 ---------------KRATEINQEMEAAAAAAAAAAAHPSEAP---------------APVEAEA 605

  Fly   362 NVREASKIVEFMRDP--KEPPP--------PPPPEKSWE 390
            :..||...||....|  .|.||        |||.|.:.|
  Fly   606 HAAEAPAAVEGDAAPAAAEAPPAGDAAPVAPPPAEPAAE 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 19/139 (14%)
PDI_a_PDIR 144..249 CDD:239295 21/109 (19%)
ER_PDI_fam 166..500 CDD:273457 50/248 (20%)
PDI_a_PDIR 272..373 CDD:239295 21/100 (21%)
PDI_a_PDIR 397..498 CDD:239295
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246
DUF4746 234..556 CDD:292550 52/291 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.