DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and prtp

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:393 Identity:101/393 - (25%)
Similarity:182/393 - (46%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 EEDPAGKDVLHFS---DAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYI 198
            :|:..||....|:   |..:|...:...  .:.|.|:.||||.||:::|.:.:.:..:......:
  Fly    27 QEEDTGKQDKQFTVELDPETFDTAIAGG--NVFVKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKV 89

  Fly   199 LAAMNVERQENAPIRKMFNITGFPTLIYFENGKLR-FTYEGENNKEALVSFM---LNPNAKPTPK 259
            :.| .|:..::..:.....:||:|||..|:.|:.. ..::|..:..|:..|:   |:..|:....
  Fly    90 IIA-KVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLG 153

  Fly   260 PKEPEWSADTN-SEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEM-KQKKI 322
            ..:.|...:.| .::|.||...|...: ...:..|.|:||||.||:|:.|.:|..|.|: |:..:
  Fly   154 EVKREQVENLNIGKVVDLTEDTFAKHV-STGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTV 217

  Fly   323 PGLLAALDATKEPSIAEKYKVKGYPTVKFFSNG--VFKFEVNVREASKIVEFMRDPKEPPPPPPP 385
              .::.:|.|:..||.:.::||||||:.:..:|  :.|:. ..|:.|.:..::    |.....|.
  Fly   218 --TISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYS-GARDLSTLKTYV----EKMVGVPL 275

  Fly   386 EKSWEEEEDSKEVL-----------------FLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKP 433
            ||:..|..|.|.|:                 ...:|.|...: .:..|.:.|||||||||:..:|
  Fly   276 EKTAGEAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAI-AEGVAFIKFYAPWCGHCQKLQP 339

  Fly   434 EFTAAATAL-QDDPRIAFVAIDCT--KLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFI 495
            .:...||.. |....:....:|||  :...:|....|.||||:..:...:.:.:|.|.|:..:..
  Fly   340 TWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQ 404

  Fly   496 AYM 498
            ||:
  Fly   405 AYL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295 23/108 (21%)
ER_PDI_fam 166..500 CDD:273457 95/361 (26%)
PDI_a_PDIR 272..373 CDD:239295 32/103 (31%)
PDI_a_PDIR 397..498 CDD:239295 30/120 (25%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 23/104 (22%)
ER_PDI_fam 39..409 CDD:273457 97/381 (25%)
PDI_a_ERp46 167..267 CDD:239303 32/103 (31%)
PDI_a_ERp46 303..407 CDD:239303 29/104 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45672
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.