DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Erp27

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:140 Identity:32/140 - (22%)
Similarity:62/140 - (44%) Gaps:33/140 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IAEYKD------FKKLLRTKNNVLALYVTSAKSAAAE-LKIFREAAEAIRGTGTMLLLDCGQQDR 86
            :.||..      |..:::|.   |.|.:..|.....| |:.:::||:..:|....:|:|.|:::.
  Rat   144 VTEYSPMIGAGLFNTMVQTH---LLLIMNKASPEYEESLRSYQKAAKLFQGQILFVLVDSGKREN 205

  Fly    87 KKLCK--KLKVSPDPYAIKHYKDGDFHKDYD----RQLSVSSMITF---------MRDPSGDLPW 136
            .|:..  :||.|..| |:..|:..|  ..:|    .:::|..:.:|         :||...    
  Rat   206 GKVIAYFRLKESQLP-ALAIYESVD--DKWDALTITEVTVEKVQSFCNGFLKGMLLRDQKA---- 263

  Fly   137 EEDPAGKDVL 146
             |:.:||:.|
  Rat   264 -ENDSGKEEL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 28/123 (23%)
PDI_a_PDIR 144..249 CDD:239295 1/3 (33%)
ER_PDI_fam 166..500 CDD:273457
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279
Thioredoxin_6 64..250 CDD:290560 26/111 (23%)
PDI_b'_family 156..253 CDD:239280 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.