DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Tmx4

DIOPT Version :10

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001093999.1 Gene:Tmx4 / 296182 RGDID:1305146 Length:336 Species:Rattus norvegicus


Alignment Length:112 Identity:30/112 - (26%)
Similarity:49/112 - (43%) Gaps:25/112 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 WSADTNSEIVHLTSQGFE-PALKDEKS----------ALVM-------FYAPWCGHCKRMKPEYE 311
            |.|...:|     ::|.| .||..|:|          .|||       ||||||..|::...|:|
  Rat    14 WLAAAAAE-----AEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWE 73

  Fly   312 KAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFK 358
            ..|...:..:|.  :..:|..:||.::.::.|...|......:|:|:
  Rat    74 TFAKNGETLQIS--VGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFR 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
PDI_a_PDIR 272..373 CDD:239295 28/105 (27%)
PDI_a_PDIR 397..498 CDD:239295
Tmx4NP_001093999.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 35..135 CDD:469754 22/86 (26%)
PTZ00121 <218..>334 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.