DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Pdia6

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001004442.1 Gene:Pdia6 / 286906 RGDID:628688 Length:445 Species:Rattus norvegicus


Alignment Length:264 Identity:83/264 - (31%)
Similarity:136/264 - (51%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 TNSEIVHLTSQGF-EPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDAT 332
            ::.:::.||...| ...::.:...||.|||||||||:|:.||::|||..:|.....|   |::|.
  Rat    28 SSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDVVKVG---AVNAD 89

  Fly   333 KEPSIAEKYKVKGYPTVKFFS---------NGVFKFEVNVREA-SKIVEFMRD-----------P 376
            |..|:..:|.|:|:||:|.|.         .|....|..|..| |.:.:.::|           .
  Rat    90 KHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSG 154

  Fly   377 KEPPPPPPPEKSWEEEEDSKEVLFLDDDNF-SSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAAT 440
            |:         ...:....|:|:.|.||.| .:.|..:...:|.||||||||||:.:||:.||||
  Rat   155 KQ---------GRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAAT 210

  Fly   441 ALQDDP--RIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIA-----YM 498
            .:::..  ::...|:|.|....|.::|.::|:|||..|...::.:||:||||..|.::     :.
  Rat   211 EVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFS 275

  Fly   499 NNPP 502
            :|.|
  Rat   276 DNAP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 81/260 (31%)
PDI_a_PDIR 272..373 CDD:239295 38/111 (34%)
PDI_a_PDIR 397..498 CDD:239295 40/108 (37%)
Pdia6NP_001004442.1 PDI_a_P5 31..133 CDD:239299 36/104 (35%)
PDI_a_P5 166..271 CDD:239299 40/104 (38%)
P5_C 280..409 CDD:239281 83/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.