DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and PDILT

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_777584.1 Gene:PDILT / 204474 HGNCID:27338 Length:584 Species:Homo sapiens


Alignment Length:347 Identity:73/347 - (21%)
Similarity:136/347 - (39%) Gaps:50/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DDIAEY----KDFKKLLRTKNNVLALYVTSAKSAAAELKIFREAAEAIRGTGTMLLLDCGQQDRK 87
            |.:.||    ||....|...:::|.....|::|....::.::.|::..:.....:|:|..:....
Human   256 DFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNG 320

  Fly    88 KLCKKLKVS----PDPYAIKHYKDGDFHKDYDRQLSVSSMITFMR----------DPSGDLP--W 136
            ::.|..:|:    |....:....|..:....| .::..|:..|.|          ..|.::|  |
Human   321 RVFKYFRVTEVDIPSVQILNLSSDARYKMPSD-DITYESLKKFGRSFLSKNATKHQSSEEIPKYW 384

  Fly   137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAA 201
            ::....:.|....:...|.|  .||:   .||||.||...||.:.|...:...:.:.....|:|.
Human   385 DQGLVKQLVGKNFNVVVFDK--EKDV---FVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAK 444

  Fly   202 MNVERQENAPIRKMFNITGFPTLIYFENGKLR-FTYEGENNKEALVSFMLNPNAKPTPKPKEPEW 265
            ::|...:   |:.|: :..:|....|.:|..: ..|:||:..:....| |..:.|...:.::...
Human   445 IDVTAND---IQLMY-LDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDF-LESHIKTKIEDEDELL 504

  Fly   266 SADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGL--LAA 328
            |.:.| |::.      |..|.:||...:|         ::..||.:...||...|.:..|  .|.
Human   505 SVEQN-EVIE------EEVLAEEKEVPMM---------RKGLPEQQSPELENMTKYVSKLEEPAG 553

  Fly   329 LDATKEPSIAEKYKVKGYPTVK 350
            ...|.|..:....|.||.|..|
Human   554 KKKTSEEVVVVVAKPKGPPVQK 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 20/121 (17%)
PDI_a_PDIR 144..249 CDD:239295 25/105 (24%)
ER_PDI_fam 166..500 CDD:273457 45/188 (24%)
PDI_a_PDIR 272..373 CDD:239295 20/81 (25%)
PDI_a_PDIR 397..498 CDD:239295
PDILTNP_777584.1 YbbN 46..501 CDD:331940 51/255 (20%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 581..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.