DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and pdi-6

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_509190.1 Gene:pdi-6 / 180974 WormBaseID:WBGene00015168 Length:440 Species:Caenorhabditis elegans


Alignment Length:250 Identity:87/250 - (34%)
Similarity:124/250 - (49%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 EIVHLTSQGFE-PALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGL--LAALDATK 333
            ::|.||...|: ..:..:...:|.||||||||||.:.|||:|||..:|     |:  :.|:|.|:
 Worm    25 DVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALK-----GVAKVGAVDMTQ 84

  Fly   334 EPSIAEKYKVKGYPTVKFFS---------NGVFKFEV----NVREASKIVEFMRDPKEPPPPPPP 385
            ..|:...|.|:|:||:|.|.         ||....:.    .:.||.|.|......|........
 Worm    85 HQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSG 149

  Fly   386 EKSWEEEE----DSKEVLFLDDDNFSS-TLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDD 445
            ..|...:.    ...||:.|.|.||.. .|..|...||.|:||||||||..:|::.|||:.|:..
 Worm   150 SGSGSGKRGGGGSGNEVVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASELKGK 214

  Fly   446 PRIAFVAIDCTKLAALCAKYNVRGYPTILYF---SYLKTKLDYNGGRTSKDFIAY 497
            .|:.  |:|.|....:..|:.:||:|||.||   |.:....||:|||.|.|.:|:
 Worm   215 VRLG--ALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 87/249 (35%)
PDI_a_PDIR 272..373 CDD:239295 40/116 (34%)
PDI_a_PDIR 397..498 CDD:239295 45/104 (43%)
pdi-6NP_509190.1 PDI_a_P5 25..127 CDD:239299 36/106 (34%)
PDI_a_P5 165..269 CDD:239299 45/104 (43%)
P5_C 278..407 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.